PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA007300-PA
Common NameOsI_05480
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Trihelix
Protein Properties Length: 711aa    MW: 75232.1 Da    PI: 6.2257
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA007300-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix100.61.2e-31525609186
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                       rW+k+ev aLi++r+ +e+r+++  lk+plWeevs++m++ g++r++k+Ckekwen+nk+++k ke+ kkr + + +tcpyfd+l+
  BGIOSGA007300-PA 525 RWPKHEVEALIRVRTGLEDRFQEPGLKGPLWEEVSARMAAAGYRRNAKRCKEKWENINKYFRKAKESGKKR-PAHAKTCPYFDELD 609
                       8********************************************************************98.99999*******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.073518582IPR017877Myb-like domain
CDDcd122031.91E-30524589No hitNo description
PfamPF138373.6E-23524611No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 711 aa     Download sequence    Send to blast
MQSGYGGVSE FQQYIMDPGA FAMSAPPQPA QAAAAAAAAA AAAAGGQELG APFRYQPLHH  60
HALPQHHHHH HPPPQMPPHL AHFGGAGGIP FTQQLLHQAA AAGHHPHLQL FHEQHHHQKH  120
QQQPPPPARW APQHHHHHHP HHHLGLDVEA AVPESSGAGA GSAASGAAAP PGVPPFLAAA  180
MSFKLGVDGG GGSGATGGTD DALNDGGGAG SGMMLHGGGG GGGGGDDEAA TESRLRRWPG  240
DEETSIKEPT WRPLDIDYIH SSSSSKRAPP KDKPATPDSP APPPPANYFK NKPDDNAAAA  300
SAASAGAVNY KLFSELEAIY KPGSGGAQTG SGSGLTGDDN AMLAPPMADL PDAAAANPPH  360
LNTSETSAGE DAHAVVQPQP QTQQPSGADA ARRKRKRRRQ EQLSASASFF ERLVQRLMEH  420
QESLHRQFLD TMERRERERA ARDEAWRRQE ADKFAREAAA RAQDRASAAA RESAIIAYLE  480
KISGETITLP PPAANPAPGA DEQDGVGKEV VAYDGEGSLQ LSSSRWPKHE VEALIRVRTG  540
LEDRFQEPGL KGPLWEEVSA RMAAAGYRRN AKRCKEKWEN INKYFRKAKE SGKKRPAHAK  600
TCPYFDELDR LYSRSGSGGG GGSSSAGGNG GEEAKGSSEL LDAVVKYPDV RCAPPGFPFD  660
GEQNEEGRTK DDGDEAHHDG DGDGDEEDVG VGVGRATDDH DDQVDESHDD H
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1391396RRKRKR
2392397RKRKRR
3392398RKRKRRR
4393398KRKRRR
5394398RKRRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.107970.0callus| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379896860.0
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00651PBMTransfer from LOC_Os02g01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622863.10.0PREDICTED: trihelix transcription factor GTL1
TrEMBLA0A0E0FZV40.0A0A0E0FZV4_ORYNI; Uncharacterized protein
TrEMBLA2WZT70.0A2WZT7_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA007300-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63993547
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.25e-39Trihelix family protein